Lineage for d4tvab5 (4tva B:475-681)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208545Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2208546Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2208547Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 2208686Protein Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain [55703] (1 species)
    this domain is non-catalytic
  7. 2208687Species Thermus thermophilus [TaxId:274] [55704] (12 PDB entries)
    identical sequence to Thermus aquaticus, TaxId: 271
  8. 2208696Domain d4tvab5: 4tva B:475-681 [270613]
    Other proteins in same PDB: d4tvaa_, d4tvab1, d4tvab2, d4tvab3, d4tvab4, d4tvab6
    automated match to d1jjcb5
    protein/RNA complex; complexed with phe, puy

Details for d4tvab5

PDB Entry: 4tva (more details), 2.6 Å

PDB Description: universal pathway for post-transfer editing reactions: insight from crystal structure of tthphers with puromycine
PDB Compounds: (B:) Phenylalanine--tRNA ligase beta subunit

SCOPe Domain Sequences for d4tvab5:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tvab5 d.104.1.1 (B:475-681) Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain {Thermus thermophilus [TaxId: 274]}
alpaffpapdnrgveapyrkeqrlrevlsglgfqevytysfmdpedarrfrldpprllll
nplapekaalrthlfpglvrvlkenldldrperallfevgrvfrereethlagllfgegv
glpwakerlsgyfllkgylealfarlglafrveaqafpflhpgvsgrvlvegeevgflga
lhpeiaqelelppvhlfelrlplpdkp

SCOPe Domain Coordinates for d4tvab5:

Click to download the PDB-style file with coordinates for d4tvab5.
(The format of our PDB-style files is described here.)

Timeline for d4tvab5: