SCOPe 2.08: Domain d4tvab5: 4tva B:475-681

Lineage for d4tvab5 (4tva B:475-681)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)

6. Protein Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain [55703] (1 species)
   this domain is non-catalytic

7. Species Thermus thermophilus [TaxId:274] [55704] (12 PDB entries)
   identical sequence to Thermus aquaticus, TaxId: 271

8. Domain d4tvab5: 4tva B:475-681 [270613]
   Other proteins in same PDB: d4tvaa_, d4tvab1, d4tvab2, d4tvab3, d4tvab4, d4tvab6
   automated match to d1jjcb5
   protein/RNA complex; complexed with phe, puy

Details for d4tvab5

PDB Entry: 4tva, 2.6 Å

PDB Description: universal pathway for post-transfer editing reactions: insight from crystal structure of tthphers with puromycine

PDB Compounds: (B:) Phenylalanine--tRNA ligase beta subunit

SCOPe Domain Sequences for d4tvab5:

Sequence; same for both SEQRES and ATOM records:

>d4tvab5 d.104.1.1 (B:475-681) Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain {Thermus thermophilus [TaxId: 274]}
alpaffpapdnrgveapyrkeqrlrevlsglgfqevytysfmdpedarrfrldpprllll
nplapekaalrthlfpglvrvlkenldldrperallfevgrvfrereethlagllfgegv
glpwakerlsgyfllkgylealfarlglafrveaqafpflhpgvsgrvlvegeevgflga
lhpeiaqelelppvhlfelrlplpdkp

Timeline for d4tvab5:

• d4tvab5 first appeared in SCOPe 2.05
  
• d4tvab5 appears in SCOPe 2.07