Lineage for d4tvab2 (4tva B:39-151)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2382744Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2383083Family b.40.4.4: Myf domain [50277] (7 protein domains)
  6. 2383093Protein Domain B2 of PheRS-beta, PheT [50278] (1 species)
  7. 2383094Species Thermus thermophilus [TaxId:274] [50279] (12 PDB entries)
    identical sequence to Thermus aquaticus, TaxId: 271
  8. 2383100Domain d4tvab2: 4tva B:39-151 [270610]
    Other proteins in same PDB: d4tvaa_, d4tvab1, d4tvab3, d4tvab4, d4tvab5, d4tvab6
    automated match to d1jjcb3
    protein/RNA complex; complexed with phe, puy

Details for d4tvab2

PDB Entry: 4tva (more details), 2.6 Å

PDB Description: universal pathway for post-transfer editing reactions: insight from crystal structure of tthphers with puromycine
PDB Compounds: (B:) Phenylalanine--tRNA ligase beta subunit

SCOPe Domain Sequences for d4tvab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tvab2 b.40.4.4 (B:39-151) Domain B2 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]}
fpiprgvvfarvleahpipgtrlkrlvldagrtvevvsgaenarkgigvalalpgtelpg
lgqkvgerviqgvrsfgmalsprelgvgeygggllefpedalppgtplseawp

SCOPe Domain Coordinates for d4tvab2:

Click to download the PDB-style file with coordinates for d4tvab2.
(The format of our PDB-style files is described here.)

Timeline for d4tvab2: