SCOPe 2.07: Domain d4tvab1: 4tva B:1-38,B:152-190

Lineage for d4tvab1 (4tva B:1-38,B:152-190)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
   core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different

4. Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families)

5. Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein)
   duplication: contains two such domains related by pseudo dyad

6. Protein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species)

7. Species Thermus thermophilus [TaxId:274] [46958] (12 PDB entries)
   identical sequence to Thermus aquaticus, TaxId: 271

8. Domain d4tvab1: 4tva B:1-38,B:152-190 [270609]
   Other proteins in same PDB: d4tvaa_, d4tvab2, d4tvab3, d4tvab5, d4tvab6
   automated match to d1jjcb1
   protein/RNA complex; complexed with phe, puy

Details for d4tvab1

PDB Entry: 4tva, 2.6 Å

PDB Description: universal pathway for post-transfer editing reactions: insight from crystal structure of tthphers with puromycine

PDB Compounds: (B:) Phenylalanine--tRNA ligase beta subunit

SCOPe Domain Sequences for d4tvab1:

Sequence; same for both SEQRES and ATOM records:

>d4tvab1 a.6.1.1 (B:1-38,B:152-190) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]}
mrvpfswlkayvpelespevleerlaglgfetdriervXeevvldlevtpnrpdalgllg
lardlhalgyalvepeaa

Timeline for d4tvab1:

• d4tvab1 first appeared in SCOPe 2.05
  
• d4tvab1 appears in SCOPe 2.06