SCOPe 2.07: Domain d4togd_: 4tog D:

Lineage for d4togd_ (4tog D:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.0: automated matches [191307] (1 protein)
   not a true family

6. Protein automated matches [190036] (58 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [270448] (10 PDB entries)

8. Domain d4togd_: 4tog D: [270607]
   automated match to d3fvba_
   complexed with hem, k, mpd, na, so4

Details for d4togd_

PDB Entry: 4tog, 1.8 Å

PDB Description: 1.80a resolution structure of bfrb (c89s, k96c) crystal form 2 from pseudomonas aeruginosa

PDB Compounds: (D:) bacterioferritin

SCOPe Domain Sequences for d4togd_:

Sequence; same for both SEQRES and ATOM records:

>d4togd_ a.25.1.0 (D:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
rilfleglpnlqdlgklligentqemlqsdlnlelcatkdlreaivhceqvhdyvsrdll
kdileseeehidyletqlgliqkvglenylqshmhe

Timeline for d4togd_:

• d4togd_ first appeared in SCOPe 2.05
  
• d4togd_ appears in SCOPe 2.06
  
• d4togd_ appears in the current release, SCOPe 2.08