Lineage for d4toga_ (4tog A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312408Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2312409Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314636Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2314637Protein automated matches [190036] (41 species)
    not a true protein
  7. 2315095Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [270448] (9 PDB entries)
  8. 2315100Domain d4toga_: 4tog A: [270603]
    automated match to d3fvba_
    complexed with hem, k, mpd, na, so4

Details for d4toga_

PDB Entry: 4tog (more details), 1.8 Å

PDB Description: 1.80a resolution structure of bfrb (c89s, k96c) crystal form 2 from pseudomonas aeruginosa
PDB Compounds: (A:) bacterioferritin

SCOPe Domain Sequences for d4toga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4toga_ a.25.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
rilfleglpnlqdlgklligentqemlqsdlnlelcatkdlreaivhceqvhdyvsrdll
kdileseeehidyletqlgliqkvglenylqshmhe

SCOPe Domain Coordinates for d4toga_:

Click to download the PDB-style file with coordinates for d4toga_.
(The format of our PDB-style files is described here.)

Timeline for d4toga_: