Lineage for d1a3wa1 (1a3w A:88-188)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16389Fold b.58: Pyruvate kinase beta-barrel domain [50799] (1 superfamily)
  4. 16390Superfamily b.58.1: Pyruvate kinase beta-barrel domain [50800] (1 family) (S)
  5. 16391Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
  6. 16392Protein Pyruvate kinase [50802] (5 species)
  7. 16393Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50806] (2 PDB entries)
  8. 16394Domain d1a3wa1: 1a3w A:88-188 [27060]
    Other proteins in same PDB: d1a3wa2, d1a3wa3, d1a3wb2, d1a3wb3

Details for d1a3wa1

PDB Entry: 1a3w (more details), 3 Å

PDB Description: pyruvate kinase from saccharomyces cerevisiae complexed with fbp, pg, mn2+ and k+
PDB Compounds: (A:)

SCOP Domain Sequences for d1a3wa1:

Sequence, based on SEQRES records: (download)

>d1a3wa1 b.58.1.1 (A:88-188) Pyruvate kinase {Baker's yeast (Saccharomyces cerevisiae)}
peirtgtttndvdypippnhemifttddkyakacddkimyvdyknitkvisagriiyvdd
gvlsfqvlevvddktlkvkalnagkicshkgvnlpgtdvdl

Sequence, based on observed residues (ATOM records): (download)

>d1a3wa1 b.58.1.1 (A:88-188) Pyruvate kinase {Baker's yeast (Saccharomyces cerevisiae)}
peirtgtttndvdypippnhemifttddkyakacddkimyvdyknitkvisagriiyvdd
gvlsfqvlevvdtlkvkalnagkicshkgvnlpgtdvdl

SCOP Domain Coordinates for d1a3wa1:

Click to download the PDB-style file with coordinates for d1a3wa1.
(The format of our PDB-style files is described here.)

Timeline for d1a3wa1: