Lineage for d4tohc_ (4toh C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2317148Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2317149Protein automated matches [190036] (58 species)
    not a true protein
  7. 2317862Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [270448] (10 PDB entries)
  8. 2317877Domain d4tohc_: 4toh C: [270599]
    automated match to d3fvba_
    complexed with fe2, hem, k, so4

Details for d4tohc_

PDB Entry: 4toh (more details), 1.8 Å

PDB Description: 1.80a resolution structure of iron bound bfrb (c89s, k96c) from pseudomonas aeruginosa
PDB Compounds: (C:) bacterioferritin

SCOPe Domain Sequences for d4tohc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tohc_ a.25.1.0 (C:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
rilfleglpnlqdlgklligentqemlqsdlnlelcatkdlreaivhceqvhdyvsrdll
kdileseeehidyletqlgliqkvglenylqshmhe

SCOPe Domain Coordinates for d4tohc_:

Click to download the PDB-style file with coordinates for d4tohc_.
(The format of our PDB-style files is described here.)

Timeline for d4tohc_: