Lineage for d1pklh1 (1pkl H:88-186)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 232326Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 232327Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 232328Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
    this domain interrupts beta/alpha-barrel domain
    C-terminal domain is alpha/beta
  6. 232329Protein Pyruvate kinase (PK) [50802] (6 species)
  7. 232367Species Leishmania mexicana [TaxId:5665] [50805] (1 PDB entry)
  8. 232375Domain d1pklh1: 1pkl H:88-186 [27059]
    Other proteins in same PDB: d1pkla2, d1pkla3, d1pklb2, d1pklb3, d1pklc2, d1pklc3, d1pkld2, d1pkld3, d1pkle2, d1pkle3, d1pklf2, d1pklf3, d1pklg2, d1pklg3, d1pklh2, d1pklh3
    complexed with so4

Details for d1pklh1

PDB Entry: 1pkl (more details), 2.35 Å

PDB Description: the structure of leishmania pyruvate kinase

SCOP Domain Sequences for d1pklh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pklh1 b.58.1.1 (H:88-186) Pyruvate kinase (PK) {Leishmania mexicana}
eirtgqfvggdavmergatcyvttdpafadkgtkdkfyidyqnlskvvrpgnyiyiddgi
lilqvqshedeqtlectvtnshtisdrrgvnlpgcdvdl

SCOP Domain Coordinates for d1pklh1:

Click to download the PDB-style file with coordinates for d1pklh1.
(The format of our PDB-style files is described here.)

Timeline for d1pklh1: