Lineage for d4toer_ (4toe R:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2704613Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [270448] (10 PDB entries)
  8. 2704731Domain d4toer_: 4toe R: [270568]
    automated match to d3fvba_
    complexed with fe2, hem, k, so4

Details for d4toer_

PDB Entry: 4toe (more details), 2.2 Å

PDB Description: 2.20a resolution structure of iron bound bfrb (d34f) from pseudomonas aeruginosa
PDB Compounds: (R:) bacterioferritin

SCOPe Domain Sequences for d4toer_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4toer_ a.25.1.0 (R:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
kgdkkviqhlnkilgneliainqyflhsrmwnfwglkrlgaheyhesidemkhadklier
ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
dileseeehidyletqlgliqkvglenylqshmhe

SCOPe Domain Coordinates for d4toer_:

Click to download the PDB-style file with coordinates for d4toer_.
(The format of our PDB-style files is described here.)

Timeline for d4toer_: