Lineage for d4to9u_ (4to9 U:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2704613Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [270448] (10 PDB entries)
  8. 2704686Domain d4to9u_: 4to9 U: [270546]
    automated match to d3fvba_
    complexed with hem, k

Details for d4to9u_

PDB Entry: 4to9 (more details), 2 Å

PDB Description: 2.0a resolution structure of bfrb (n148l) from pseudomonas aeruginosa
PDB Compounds: (U:) bacterioferritin

SCOPe Domain Sequences for d4to9u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4to9u_ a.25.1.0 (U:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
gdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklieri
lfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllkd
ileseeehidyletqlgliqkvglelylqshmhe

SCOPe Domain Coordinates for d4to9u_:

Click to download the PDB-style file with coordinates for d4to9u_.
(The format of our PDB-style files is described here.)

Timeline for d4to9u_: