![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
![]() | Protein automated matches [190036] (60 species) not a true protein |
![]() | Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [270448] (10 PDB entries) |
![]() | Domain d4to9q_: 4to9 Q: [270543] automated match to d3fvba_ complexed with hem, k |
PDB Entry: 4to9 (more details), 2 Å
SCOPe Domain Sequences for d4to9q_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4to9q_ a.25.1.0 (Q:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]} gdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklieri lfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllkd ileseeehidyletqlgliqkvglelylqshmhe
Timeline for d4to9q_: