| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
| Protein automated matches [190036] (60 species) not a true protein |
| Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [270448] (10 PDB entries) |
| Domain d4to9m_: 4to9 M: [270538] automated match to d3fvba_ complexed with hem, k |
PDB Entry: 4to9 (more details), 2 Å
SCOPe Domain Sequences for d4to9m_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4to9m_ a.25.1.0 (M:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
gdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklieri
lfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllkd
ileseeehidyletqlgliqkvglelylqshmhe
Timeline for d4to9m_: