Lineage for d1pkm_1 (1pkm 116-217)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16389Fold b.58: Pyruvate kinase beta-barrel domain [50799] (1 superfamily)
  4. 16390Superfamily b.58.1: Pyruvate kinase beta-barrel domain [50800] (1 family) (S)
  5. 16391Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
  6. 16392Protein Pyruvate kinase [50802] (5 species)
  7. 16398Species Cat (Felis domestica) [TaxId:9685] [50804] (1 PDB entry)
  8. 16399Domain d1pkm_1: 1pkm 116-217 [27051]
    Other proteins in same PDB: d1pkm_2, d1pkm_3

Details for d1pkm_1

PDB Entry: 1pkm (more details), 2.6 Å

PDB Description: the refined three-dimensional structure of cat muscle (m1) pyruvate kinase, at a resolution of 2.6 angstroms

SCOP Domain Sequences for d1pkm_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkm_1 b.58.1.1 (116-217) Pyruvate kinase {Cat (Felis domestica)}
peirtglikgsgtaevelkkgatlkitldnaymekcdenvlwldyknickvvevgskvyv
ddglisllvkekgadflvtevenggslgskkgvnlpgaavdl

SCOP Domain Coordinates for d1pkm_1:

Click to download the PDB-style file with coordinates for d1pkm_1.
(The format of our PDB-style files is described here.)

Timeline for d1pkm_1: