SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1pkma1 (1pkm A:116-217)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2062352Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 2062353Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 2062354Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
    this domain interrupts beta/alpha-barrel domain
    C-terminal domain is alpha/beta
  6. 2062355Protein Pyruvate kinase (PK) [50802] (6 species)
  7. 2062361Species Cat (Felis catus) [TaxId:9685] [50804] (1 PDB entry)
  8. 2062362Domain d1pkma1: 1pkm A:116-217 [27051]
    Other proteins in same PDB: d1pkma2, d1pkma3

Details for d1pkma1

PDB Entry: 1pkm (more details), 2.6 Å

PDB Description: the refined three-dimensional structure of cat muscle (m1) pyruvate kinase, at a resolution of 2.6 angstroms
PDB Compounds: (A:) m1 pyruvate kinase

SCOPe Domain Sequences for d1pkma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkma1 b.58.1.1 (A:116-217) Pyruvate kinase (PK) {Cat (Felis catus) [TaxId: 9685]}
peirtglikgsgtaevelkkgatlkitldnaymekcdenvlwldyknickvvevgskvyv
ddglisllvkekgadflvtevenggslgskkgvnlpgaavdl

SCOPe Domain Coordinates for d1pkma1:

Click to download the PDB-style file with coordinates for d1pkma1.
(The format of our PDB-style files is described here.)

Timeline for d1pkma1: