| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.1: Ferritin [47241] (10 proteins) |
| Protein automated matches [190041] (34 species) not a true protein |
| Species Pseudomonas aeruginosa [TaxId:287] [189215] (23 PDB entries) |
| Domain d4tobd_: 4tob D: [270500] automated match to d4e6ka_ complexed with hem, mes |
PDB Entry: 4tob (more details), 1.95 Å
SCOPe Domain Sequences for d4tobd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tobd_ a.25.1.1 (D:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
dileseeehidyletqlgliqkvglenyllshmhe
Timeline for d4tobd_: