| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
| Protein automated matches [190036] (33 species) not a true protein |
| Species Pseudomonas aeruginosa [TaxId:208964] [270448] (9 PDB entries) |
| Domain d4toac_: 4toa C: [270480] automated match to d3fvba_ complexed with fe2, hem, k, so4 |
PDB Entry: 4toa (more details), 1.95 Å
SCOPe Domain Sequences for d4toac_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4toac_ a.25.1.0 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
dileseeehidyletqlgliqkvglelylqshmhe
Timeline for d4toac_: