Lineage for d1aqfe1 (1aqf E:116-217)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 113337Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
  4. 113338Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 113339Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
  6. 113340Protein Pyruvate kinase (PK) [50802] (5 species)
  7. 113370Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [50803] (6 PDB entries)
  8. 113391Domain d1aqfe1: 1aqf E:116-217 [27047]
    Other proteins in same PDB: d1aqfa2, d1aqfa3, d1aqfb2, d1aqfb3, d1aqfc2, d1aqfc3, d1aqfd2, d1aqfd3, d1aqfe2, d1aqfe3, d1aqff2, d1aqff3, d1aqfg2, d1aqfg3, d1aqfh2, d1aqfh3

Details for d1aqfe1

PDB Entry: 1aqf (more details), 2.7 Å

PDB Description: pyruvate kinase from rabbit muscle with mg, k, and l-phospholactate
PDB Compounds: (E:)

SCOP Domain Sequences for d1aqfe1:

Sequence, based on SEQRES records: (download)

>d1aqfe1 b.58.1.1 (E:116-217) Pyruvate kinase (PK) {Rabbit (Oryctolagus cuniculus)}
peirtglikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyv
ddglislqvkqkgpdflvtevenggflgskkgvnlpgaavdl

Sequence, based on observed residues (ATOM records): (download)

>d1aqfe1 b.58.1.1 (E:116-217) Pyruvate kinase (PK) {Rabbit (Oryctolagus cuniculus)}
pepgaavdl

SCOP Domain Coordinates for d1aqfe1:

Click to download the PDB-style file with coordinates for d1aqfe1.
(The format of our PDB-style files is described here.)

Timeline for d1aqfe1: