Lineage for d4tn4c_ (4tn4 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2897670Species Plasmodium vivax [TaxId:126793] [261543] (24 PDB entries)
  8. 2897685Domain d4tn4c_: 4tn4 C: [270445]
    automated match to d4pffa_
    complexed with 33g, bme, cl, plg

Details for d4tn4c_

PDB Entry: 4tn4 (more details), 2.2 Å

PDB Description: crystal structure of ternary complex of plasmodium vivax shmt with glycine and a novel pyrazolopyran 33g: (4s)-6-amino-4-(5-cyano-3'- fluorobiphenyl-3-yl)-4-cyclobutyl-3-methyl-2,4-dihydropyrano[2,3- c]pyrazole-5-carbonitrile
PDB Compounds: (C:) serine hydroxymethyltransferase

SCOPe Domain Sequences for d4tn4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tn4c_ c.67.1.0 (C:) automated matches {Plasmodium vivax [TaxId: 126793]}
mfnnepleqidkelhdiladeekrqretinliasenltngavreclgnrvsnkysegypk
kryyggndfidkieelcqkraleafnvsdeewgvnvqplsgsaanvqalyalvgvkgkim
gmhlcsgghlthgffdekkkvsitsdmfesklykcnsqgyvdldavremalsfkpkviic
gytsyprdidyqqfrqicdevnaylfadishissfvacnilnnpflhadvvtttthkilr
gprsaliffnkkrnpgieqkinsavfpsfqggphnnkiaavacqlkevhspafkeytqqv
llnskalakaliskqidlvtngtdnhlivvdlrkfsitgsklqetcnainvslnkntips
dvdcvspsgvrigtpamttrgakekdmefiadvlaraikitvdlqeqygkklvdfkkglp
gnaqlqqlkqevvtwagalpfp

SCOPe Domain Coordinates for d4tn4c_:

Click to download the PDB-style file with coordinates for d4tn4c_.
(The format of our PDB-style files is described here.)

Timeline for d4tn4c_: