Lineage for d1aqfb1 (1aqf B:116-217)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1132798Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 1132799Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 1132800Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
    this domain interrupts beta/alpha-barrel domain
    C-terminal domain is alpha/beta
  6. 1132801Protein Pyruvate kinase (PK) [50802] (6 species)
  7. 1132839Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [50803] (7 PDB entries)
  8. 1132865Domain d1aqfb1: 1aqf B:116-217 [27044]
    Other proteins in same PDB: d1aqfa2, d1aqfa3, d1aqfb2, d1aqfb3, d1aqfc2, d1aqfc3, d1aqfd2, d1aqfd3, d1aqfe2, d1aqfe3, d1aqff2, d1aqff3, d1aqfg2, d1aqfg3, d1aqfh2, d1aqfh3
    complexed with k, mg, peq

Details for d1aqfb1

PDB Entry: 1aqf (more details), 2.7 Å

PDB Description: pyruvate kinase from rabbit muscle with mg, k, and l-phospholactate
PDB Compounds: (B:) pyruvate kinase

SCOPe Domain Sequences for d1aqfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aqfb1 b.58.1.1 (B:116-217) Pyruvate kinase (PK) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
peirtglikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyv
ddglislqvkqkgpdflvtevenggflgskkgvnlpgaavdl

SCOPe Domain Coordinates for d1aqfb1:

Click to download the PDB-style file with coordinates for d1aqfb1.
(The format of our PDB-style files is described here.)

Timeline for d1aqfb1: