Lineage for d4s1wa_ (4s1w A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140243Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2140244Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2140444Family c.80.1.0: automated matches [191405] (1 protein)
    not a true family
  6. 2140445Protein automated matches [190547] (14 species)
    not a true protein
  7. 2140530Species Staphylococcus aureus [TaxId:46170] [270435] (1 PDB entry)
  8. 2140531Domain d4s1wa_: 4s1w A: [270437]
    automated match to d1mosa_
    complexed with peg

Details for d4s1wa_

PDB Entry: 4s1w (more details), 1.65 Å

PDB Description: structure of a putative glutamine--fructose-6-phosphate aminotransferase from staphylococcus aureus subsp. aureus mu50
PDB Compounds: (A:) Glutamine--fructose-6-phosphate aminotransferase [isomerizing]

SCOPe Domain Sequences for d4s1wa_:

Sequence, based on SEQRES records: (download)

>d4s1wa_ c.80.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 46170]}
vyahymlkeiheqpavmrriiqeyqdaegnlkidqdiindvkeadriyviaagtsyhagl
vgkeflekwagvptevhvasefvynmpllsekplfvyisqsgetadsravlvetnklghk
sltitnvagstlsreadhtlllhagpeiavastkaytaqiavlsilsqivakehgreadi
dllrelakvttaieaivddapimeqiatdflettrnaffigrtidynvslegalklkeis
yiqaegfaggelkhgtialiedgtpvvalatqenvnlsirgnvkevvargahpciismeg
lekegdtyviphvhelltplvsvvalqlisyyaalhrd

Sequence, based on observed residues (ATOM records): (download)

>d4s1wa_ c.80.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 46170]}
vyahymlkeiheqpavmrriiqeyqdaegnlkidqdiindvkeadriyviaagtsyhagl
vgkeflekwagvptevhvasefvynmpllsekplfvyisqsgetadsravlvetnklghk
sltitnvagstlsreadhtlllhagpeiavastkaytaqiavlsilsqivakeheadidl
lrelakvttaieaivddapimeqiatdflettrnaffigrtidynvslegalklkeisyi
qaegfaggelkhgtialiedgtpvvalatqenvnlsirgnvkevvargahpciismegle
kegdtyviphvhelltplvsvvalqlisyyaalhrd

SCOPe Domain Coordinates for d4s1wa_:

Click to download the PDB-style file with coordinates for d4s1wa_.
(The format of our PDB-style files is described here.)

Timeline for d4s1wa_: