Lineage for d1aqfa1 (1aqf A:116-217)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 169754Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
  4. 169755Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 169756Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
  6. 169757Protein Pyruvate kinase (PK) [50802] (5 species)
  7. 169787Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [50803] (6 PDB entries)
  8. 169804Domain d1aqfa1: 1aqf A:116-217 [27043]
    Other proteins in same PDB: d1aqfa2, d1aqfa3, d1aqfb2, d1aqfb3, d1aqfc2, d1aqfc3, d1aqfd2, d1aqfd3, d1aqfe2, d1aqfe3, d1aqff2, d1aqff3, d1aqfg2, d1aqfg3, d1aqfh2, d1aqfh3

Details for d1aqfa1

PDB Entry: 1aqf (more details), 2.7 Å

PDB Description: pyruvate kinase from rabbit muscle with mg, k, and l-phospholactate

SCOP Domain Sequences for d1aqfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aqfa1 b.58.1.1 (A:116-217) Pyruvate kinase (PK) {Rabbit (Oryctolagus cuniculus)}
peirtglikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyv
ddglislqvkqkgpdflvtevenggflgskkgvnlpgaavdl

SCOP Domain Coordinates for d1aqfa1:

Click to download the PDB-style file with coordinates for d1aqfa1.
(The format of our PDB-style files is described here.)

Timeline for d1aqfa1: