Lineage for d1pkn_1 (1pkn 116-217)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 62010Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
  4. 62011Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 62012Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
  6. 62013Protein Pyruvate kinase (PK) [50802] (5 species)
  7. 62043Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [50803] (4 PDB entries)
  8. 62060Domain d1pkn_1: 1pkn 116-217 [27042]
    Other proteins in same PDB: d1pkn_2, d1pkn_3

Details for d1pkn_1

PDB Entry: 1pkn (more details), 2.9 Å

PDB Description: structure of rabbit muscle pyruvate kinase complexed with mn2+, k+, and pyruvate

SCOP Domain Sequences for d1pkn_1:

Sequence, based on SEQRES records: (download)

>d1pkn_1 b.58.1.1 (116-217) Pyruvate kinase (PK) {Rabbit (Oryctolagus cuniculus)}
peirtglikgsgtaevelkkgatlkitldnaymaacdenilwldyknickvvevgskvyv
ddglislqvkqkgpdflvtevenggflgskkgvnlpgaavdl

Sequence, based on observed residues (ATOM records): (download)

>d1pkn_1 b.58.1.1 (116-217) Pyruvate kinase (PK) {Rabbit (Oryctolagus cuniculus)}
peirtglikgselkkgatlkitldnaymaacdenilwldyknickvvevgskvyvddgli
slqvkqkgpdflvtevenggflgskkgvnlpgaavdl

SCOP Domain Coordinates for d1pkn_1:

Click to download the PDB-style file with coordinates for d1pkn_1.
(The format of our PDB-style files is described here.)

Timeline for d1pkn_1: