Lineage for d4r1va_ (4r1v A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2219750Protein Hepatocyte growth factor receptor, c-MET [103300] (1 species)
    PTK group; HGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2219751Species Human (Homo sapiens) [TaxId:9606] [103301] (52 PDB entries)
  8. 2219754Domain d4r1va_: 4r1v A: [270418]
    automated match to d3rhka_
    complexed with 3e8, gbl

Details for d4r1va_

PDB Entry: 4r1v (more details), 1.2 Å

PDB Description: identification and optimization of pyridazinones as potent and selective c-met kinase inhibitors
PDB Compounds: (A:) Hepatocyte growth factor receptor

SCOPe Domain Sequences for d4r1va_:

Sequence, based on SEQRES records: (download)

>d4r1va_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}
lsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcavkslnr
itdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirneth
nptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardmydkey
ysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditv
yllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfi

Sequence, based on observed residues (ATOM records): (download)

>d4r1va_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}
lsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcavkslnr
itdigevsqfltegiimkdfshpnvlsllgiclrssplvvlpymkhgdlrnfirnethnp
tvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardmydkeyys
vhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyl
lqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfi

SCOPe Domain Coordinates for d4r1va_:

Click to download the PDB-style file with coordinates for d4r1va_.
(The format of our PDB-style files is described here.)

Timeline for d4r1va_: