Lineage for d4q23a_ (4q23 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010547Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2010548Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2010549Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 protein domains)
  6. 2010594Protein automated matches [190489] (5 species)
    not a true protein
  7. 2010595Species Human (Homo sapiens) [TaxId:9606] [187688] (78 PDB entries)
  8. 2010636Domain d4q23a_: 4q23 A: [270391]
    automated match to d4demf_
    complexed with mg, ris, so4

Details for d4q23a_

PDB Entry: 4q23 (more details), 1.98 Å

PDB Description: the role of threonine 201 and tyrosine 204 in the human farnesyl pyrophosphate synthase catalytic mechanism and the mode of inhibition by the nitrogen-containing bisphosphonates
PDB Compounds: (A:) farnesyl pyrophosphate synthase

SCOPe Domain Sequences for d4q23a_:

Sequence, based on SEQRES records: (download)

>d4q23a_ a.128.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vyaqekqdfvqhfsqivrvltedemghpeigdaiarlkevleynaiggkynrgltvvvaf
relveprkqdadslqrawtvgwcvellqafflvaddimdssltrrgqicwyqkpgvglda
indanlleaciyrllklycreqpyylnlielflqssyqteigqtldlltapqgnvdlvrf
tekryksivkykaafysfylpiaaamymagidgekehanakkillemgeffqiqddyldl
fgdpsvtgkigtdiqdnkcswlvvqclqratpeqyqilkenygqkeaekvarvkalyeel
dlpavflqyeedsyshimalieqyaaplppavflglarkiy

Sequence, based on observed residues (ATOM records): (download)

>d4q23a_ a.128.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vyaqekqdfvqhfsqivrvltghpeigdaiarlkevleynaiggkynrgltvvvafrelv
eprkqdadslqrawtvgwcvellqafflvaddimdssltrrgqicwyqkpgvgldainda
nlleaciyrllklycreqpyylnlielflqssyqteigqtldlltapqgnvdlvrftekr
yksivkykaafysfylpiaaamymagidgekehanakkillemgeffqiqddyldlfgdp
svtgkigtdiqdnkcswlvvqclqratpeqyqilkenygqkeaekvarvkalyeeldlpa
vflqyeedsyshimalieqyaaplppavflglarkiy

SCOPe Domain Coordinates for d4q23a_:

Click to download the PDB-style file with coordinates for d4q23a_.
(The format of our PDB-style files is described here.)

Timeline for d4q23a_: