Lineage for d4pz2c_ (4pz2 C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2481726Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2481727Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2482164Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2482165Protein automated matches [190683] (55 species)
    not a true protein
  7. 2482430Species Maize (Zea mays) [TaxId:4577] [226595] (4 PDB entries)
  8. 2482437Domain d4pz2c_: 4pz2 C: [270389]
    automated match to d4wj9a_
    complexed with edo, na, nad, peg

Details for d4pz2c_

PDB Entry: 4pz2 (more details), 2.4 Å

PDB Description: structure of zm aldh2-6 (rf2f) in complex with nad
PDB Compounds: (C:) ZmALDH

SCOPe Domain Sequences for d4pz2c_:

Sequence, based on SEQRES records: (download)

>d4pz2c_ c.82.1.0 (C:) automated matches {Maize (Zea mays) [TaxId: 4577]}
lfdvpeirftklfingsfvdavsgrtfdtrdprtggviasvaeadkedvdlavraaraaf
dhgewprmsgsergrimarladlveehagelaalesldagkhpavtravdvgnaagslry
fagaadkihgetlkmpgqfqghtlreplgvagviipwnfpstmfavkvapalaagcalvv
kpaeqtplsalylaqlakqagvpdgvinvvpgfgptagaalashmdvdmvsftgstevgr
limkasaesnlkpvylelggksplivfddadldmavelavgasffnkgeacvaasrvyvq
ervydrfeerlaermrswvvgdpfsdpradqgpqvdkaqyervlsyidhgkregatlltg
grpcapegkgyyieptvftnvkedmiiakeeifgpvmclmkfktveeaiarandtryglg
agvvtrdldvanrvvrsvragvvwvncyfamgsdcpfggrkmsgfgkdegmhaldkylav
ksvvtplraspwi

Sequence, based on observed residues (ATOM records): (download)

>d4pz2c_ c.82.1.0 (C:) automated matches {Maize (Zea mays) [TaxId: 4577]}
lfdvpeirftklfingsfvdavsgrtfdtrdprtggviasvaeadkedvdlavraaraaf
dhgewprmsgsergrimarladlveehagelaalesldagkhpavtravdvgnaagslry
fagaadkihgetlkmpgqfqghtlreplgvagviipwnfpstmfavkvapalaagcalvv
kpaeqtplsalylaqlakqagvpdgvinvvpgfgptagaalashmdvdmvsftgstevgr
limkasaesnlkpvylelggksplivfddadldmavelavgasffnkgeacvaasrvyvq
ervydrfeerlaermrswvvgdpfsdpradqgpqvdkaqyervlsyidhgkregatlltg
grpcapkgyyieptvftnvkedmiiakeeifgpvmclmkfktveeaiarandtryglgag
vvtrdldvanrvvrsvragvvwvncyfamgsdcpfggrkmsgfgkdegmhaldkylavks
vvtplraspwi

SCOPe Domain Coordinates for d4pz2c_:

Click to download the PDB-style file with coordinates for d4pz2c_.
(The format of our PDB-style files is described here.)

Timeline for d4pz2c_: