Lineage for d4pz2b_ (4pz2 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (49 species)
    not a true protein
  7. 2141320Species Maize (Zea mays) [TaxId:4577] [226595] (4 PDB entries)
  8. 2141326Domain d4pz2b_: 4pz2 B: [270387]
    automated match to d4wj9a_
    complexed with edo, na, nad, peg

Details for d4pz2b_

PDB Entry: 4pz2 (more details), 2.4 Å

PDB Description: structure of zm aldh2-6 (rf2f) in complex with nad
PDB Compounds: (B:) ZmALDH

SCOPe Domain Sequences for d4pz2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pz2b_ c.82.1.0 (B:) automated matches {Maize (Zea mays) [TaxId: 4577]}
llfdvpeirftklfingsfvdavsgrtfdtrdprtggviasvaeadkedvdlavraaraa
fdhgewprmsgsergrimarladlveehagelaalesldagkhpavtravdvgnaagslr
yfagaadkihgetlkmpgqfqghtlreplgvagviipwnfpstmfavkvapalaagcalv
vkpaeqtplsalylaqlakqagvpdgvinvvpgfgptagaalashmdvdmvsftgstevg
rlimkasaesnlkpvylelggksplivfddadldmavelavgasffnkgeacvaasrvyv
qervydrfeerlaermrswvvgdpfsdpradqgpqvdkaqyervlsyidhgkregatllt
ggrpcapegkgyyieptvftnvkedmiiakeeifgpvmclmkfktveeaiarandtrygl
gagvvtrdldvanrvvrsvragvvwvncyfamgsdcpfggrkmsgfgkdegmhaldkyla
vksvvtplraspwi

SCOPe Domain Coordinates for d4pz2b_:

Click to download the PDB-style file with coordinates for d4pz2b_.
(The format of our PDB-style files is described here.)

Timeline for d4pz2b_: