![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
![]() | Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) ![]() |
![]() | Family d.32.1.1: Glyoxalase I (lactoylglutathione lyase) [54594] (2 proteins) duplication: consists of two clear structural repeats each having this fold |
![]() | Protein automated matches [190953] (2 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188562] (7 PDB entries) |
![]() | Domain d4pv5a_: 4pv5 A: [270381] automated match to d1qipb_ complexed with cbw, zn |
PDB Entry: 4pv5 (more details), 2.3 Å
SCOPe Domain Sequences for d4pv5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pv5a_ d.32.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} detafsccsdpdpstkdfllqqtmlrikdpkksldfytrvlgltllqkldfpamkfslyf layedkndipkdksektawtfsrkatlelthnwgteddetqsyhngnsdprgfghigiav pdvysackrfeelgvkfvkkpddgkmkglafiqdpdgywieilnpnkiat
Timeline for d4pv5a_: