Lineage for d4psaa1 (4psa A:5-269)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2112131Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 protein domains)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2112689Protein automated matches [190393] (10 species)
    not a true protein
  7. 2112743Species Mycobacterium tuberculosis [TaxId:1773] [270301] (16 PDB entries)
  8. 2112749Domain d4psaa1: 4psa A:5-269 [270375]
    Other proteins in same PDB: d4psaa2
    automated match to d2zrea1
    complexed with edo, gol, na

Details for d4psaa1

PDB Entry: 4psa (more details), 2.65 Å

PDB Description: mycobacterium tuberculosis reca glycerol bound low temperature structure iic-n1
PDB Compounds: (A:) Protein RecA, 1st part, 2nd part

SCOPe Domain Sequences for d4psaa1:

Sequence, based on SEQRES records: (download)

>d4psaa1 c.37.1.11 (A:5-269) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
pdrekalelavaqieksygkgsvmrlgdearqpisviptgsialdvalgigglprgrvie
iygpessgkttvalhavanaqaaggvaafidaehaldpdyakklgvdtdsllvsqpdtge
qaleiadmlirsgaldivvidsvaalvpraelegemgdshvglqarlmsqalrkmtgaln
nsgttaifinqlrdkigvmfgspetttggkalkfyasvrmdvrrvetlkdgtnavgnrtr
vkvvknkcsppfkqaefdilygkgi

Sequence, based on observed residues (ATOM records): (download)

>d4psaa1 c.37.1.11 (A:5-269) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
pdrekalelavaqieksygkgsvmrlgdearqpisviptgsialdvalgigglprgrvie
iygpessgkttvalhavanaqaaggvaafidaehaldpdyakklgvdtdsllvsqpdtge
qaleiadmlirsgaldivvidsvaalvpraelegehvglqarlmsqalrkmtgalnnsgt
taifinqltttggkalkfyasvrmdvrrvetlkdgtnavgnrtrvkvvknkcsppfkqae
fdilygkgi

SCOPe Domain Coordinates for d4psaa1:

Click to download the PDB-style file with coordinates for d4psaa1.
(The format of our PDB-style files is described here.)

Timeline for d4psaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4psaa2