![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.48: Anti-LPS factor/recA domain [54751] (2 superfamilies) alpha-beta(3)-alpha(2); 2 layers, alpha/beta |
![]() | Superfamily d.48.1: RecA protein, C-terminal domain [54752] (2 families) ![]() |
![]() | Family d.48.1.0: automated matches [227236] (1 protein) not a true family |
![]() | Protein automated matches [226990] (3 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [270303] (16 PDB entries) |
![]() | Domain d4psva2: 4psv A:270-332 [270374] Other proteins in same PDB: d4psva1 automated match to d2zrma2 complexed with po4 |
PDB Entry: 4psv (more details), 2.6 Å
SCOPe Domain Sequences for d4psva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4psva2 d.48.1.0 (A:270-332) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} sregslidmgvdqglirksgawftyegeqlgqgkenarnflvenadvadeiekkikeklg iga
Timeline for d4psva2: