![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily) barrel, closed; n=7, S=10; complex topology |
![]() | Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) ![]() |
![]() | Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein) this domain interrupts beta/alpha-barrel domain C-terminal domain is alpha/beta |
![]() | Protein Pyruvate kinase (PK) [50802] (6 species) |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [50803] (7 PDB entries) |
![]() | Domain d1a5ud1: 1a5u D:1916-2017 [27037] Other proteins in same PDB: d1a5ua2, d1a5ua3, d1a5ub2, d1a5ub3, d1a5uc2, d1a5uc3, d1a5ud2, d1a5ud3, d1a5ue2, d1a5ue3, d1a5uf2, d1a5uf3, d1a5ug2, d1a5ug3, d1a5uh2, d1a5uh3 complexed with atp, mg, na, oxl |
PDB Entry: 1a5u (more details), 2.35 Å
SCOPe Domain Sequences for d1a5ud1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a5ud1 b.58.1.1 (D:1916-2017) Pyruvate kinase (PK) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} peirtglikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyv ddglislqvkqkgpdflvtevenggflgskkgvnlpgaavdl
Timeline for d1a5ud1: