Lineage for d4ppga2 (4ppg A:270-332)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946749Fold d.48: Anti-LPS factor/recA domain [54751] (2 superfamilies)
    alpha-beta(3)-alpha(2); 2 layers, alpha/beta
  4. 2946750Superfamily d.48.1: RecA protein, C-terminal domain [54752] (2 families) (S)
  5. 2946780Family d.48.1.0: automated matches [227236] (1 protein)
    not a true family
  6. 2946781Protein automated matches [226990] (3 species)
    not a true protein
  7. 2946795Species Mycobacterium tuberculosis [TaxId:1773] [270303] (16 PDB entries)
  8. 2946811Domain d4ppga2: 4ppg A:270-332 [270366]
    Other proteins in same PDB: d4ppga1
    automated match to d2zrma2
    complexed with flc

Details for d4ppga2

PDB Entry: 4ppg (more details), 3 Å

PDB Description: mycobacterium tuberculosis reca citrate bound low temperature structure iia-br
PDB Compounds: (A:) Protein RecA, 1st part, 2nd part

SCOPe Domain Sequences for d4ppga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ppga2 d.48.1.0 (A:270-332) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
sregslidmgvdqglirksgawftyegeqlgqgkenarnflvenadvadeiekkikeklg
iga

SCOPe Domain Coordinates for d4ppga2:

Click to download the PDB-style file with coordinates for d4ppga2.
(The format of our PDB-style files is described here.)

Timeline for d4ppga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ppga1