SCOP 1.69: Domain d1a5uc1: 1a5u C:1316-1417

Lineage for d1a5uc1 (1a5u C:1316-1417)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
   barrel, closed; n=7, S=10; complex topology

4. Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families)

5. Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
   this domain interrupts beta/alpha-barrel domain
   C-terminal domain is alpha/beta

6. Protein Pyruvate kinase (PK) [50802] (6 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [50803] (6 PDB entries)

8. Domain d1a5uc1: 1a5u C:1316-1417 [27036]
   Other proteins in same PDB: d1a5ua2, d1a5ua3, d1a5ub2, d1a5ub3, d1a5uc2, d1a5uc3, d1a5ud2, d1a5ud3, d1a5ue2, d1a5ue3, d1a5uf2, d1a5uf3, d1a5ug2, d1a5ug3, d1a5uh2, d1a5uh3

Details for d1a5uc1

PDB Entry: 1a5u, 2.35 Å

PDB Description: pyruvate kinase complex with bis mg-atp-na-oxalate

SCOP Domain Sequences for d1a5uc1:

Sequence; same for both SEQRES and ATOM records:

>d1a5uc1 b.58.1.1 (C:1316-1417) Pyruvate kinase (PK) {Rabbit (Oryctolagus cuniculus)}
peirtglikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyv
ddglislqvkqkgpdflvtevenggflgskkgvnlpgaavdl

Timeline for d1a5uc1:

• d1a5uc1 first appeared (with stable ids) in SCOP 1.55
  
• d1a5uc1 appears in SCOP 1.67
  
• d1a5uc1 appears in SCOP 1.71
  
• d1a5uc1 appears in the current release, SCOPe 2.08