Lineage for d4po9a2 (4po9 A:270-329)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904179Fold d.48: Anti-LPS factor/recA domain [54751] (2 superfamilies)
    alpha-beta(3)-alpha(2); 2 layers, alpha/beta
  4. 1904180Superfamily d.48.1: RecA protein, C-terminal domain [54752] (2 families) (S)
  5. 1904210Family d.48.1.0: automated matches [227236] (1 protein)
    not a true family
  6. 1904211Protein automated matches [226990] (3 species)
    not a true protein
  7. 1904225Species Mycobacterium tuberculosis [TaxId:1773] [270303] (16 PDB entries)
  8. 1904233Domain d4po9a2: 4po9 A:270-329 [270352]
    Other proteins in same PDB: d4po9a1
    automated match to d2zrma2
    complexed with edo, gol, na

Details for d4po9a2

PDB Entry: 4po9 (more details), 2.75 Å

PDB Description: mycobacterium tuberculosis reca glycerol bound low temperature structure iic-br
PDB Compounds: (A:) Protein RecA, 1st part, 2nd part

SCOPe Domain Sequences for d4po9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4po9a2 d.48.1.0 (A:270-329) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
sregslidmgvdqglirksgawftyegeqlgqgkenarnflvenadvadeiekkikeklg

SCOPe Domain Coordinates for d4po9a2:

Click to download the PDB-style file with coordinates for d4po9a2.
(The format of our PDB-style files is described here.)

Timeline for d4po9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4po9a1