SCOPe 2.07: Domain d4pbpc_: 4pbp C:

Lineage for d4pbpc_ (4pbp C:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (66 species)
   not a true protein

7. Species Zebrafish (Danio rerio) [TaxId:7955] [270344] (3 PDB entries)

8. Domain d4pbpc_: 4pbp C: [270348]
   automated match to d3pvna_
   complexed with ca, gol

Details for d4pbpc_

PDB Entry: 4pbp, 1.65 Å

PDB Description: crystal structure of zebrafish short-chain pentraxin protein

PDB Compounds: (C:) c-reactive protein

SCOPe Domain Sequences for d4pbpc_:

Sequence; same for both SEQRES and ATOM records:

>d4pbpc_ b.29.1.0 (C:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
fknlsgkvlqfktatdnsyvklypekplslsaftlcmrvatelpldrevilfayytpdvd
elnvwrerdgrvslyiqsskdaaffrlpplstlqthlcvawesatgltafwmdgrrslhq
vyrkgysirsggtvvlgqdpdsyvgsfdvdqsfvgeianlqmwdyvlssaqikavyynqd
nrvkgnvfdwdtieydvtgnvlvvpdn

Timeline for d4pbpc_:

• d4pbpc_ first appeared in SCOPe 2.05
  
• d4pbpc_ appears in SCOPe 2.06
  
• d4pbpc_ appears in the current release, SCOPe 2.08