![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
![]() | Protein automated matches [190437] (70 species) not a true protein |
![]() | Species Zebrafish (Danio rerio) [TaxId:7955] [270344] (3 PDB entries) |
![]() | Domain d4pbpc_: 4pbp C: [270348] automated match to d3pvna_ complexed with ca, gol |
PDB Entry: 4pbp (more details), 1.65 Å
SCOPe Domain Sequences for d4pbpc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pbpc_ b.29.1.0 (C:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]} fknlsgkvlqfktatdnsyvklypekplslsaftlcmrvatelpldrevilfayytpdvd elnvwrerdgrvslyiqsskdaaffrlpplstlqthlcvawesatgltafwmdgrrslhq vyrkgysirsggtvvlgqdpdsyvgsfdvdqsfvgeianlqmwdyvlssaqikavyynqd nrvkgnvfdwdtieydvtgnvlvvpdn
Timeline for d4pbpc_: