Lineage for d4pbpb_ (4pbp B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2781453Species Zebrafish (Danio rerio) [TaxId:7955] [270344] (3 PDB entries)
  8. 2781455Domain d4pbpb_: 4pbp B: [270346]
    automated match to d3pvna_
    complexed with ca, gol

Details for d4pbpb_

PDB Entry: 4pbp (more details), 1.65 Å

PDB Description: crystal structure of zebrafish short-chain pentraxin protein
PDB Compounds: (B:) c-reactive protein

SCOPe Domain Sequences for d4pbpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pbpb_ b.29.1.0 (B:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
meffknlsgkvlqfktatdnsyvklypekplslsaftlcmrvatelpldrevilfayytp
dvdelnvwrerdgrvslyiqsskdaaffrlpplstlqthlcvawesatgltafwmdgrrs
lhqvyrkgysirsggtvvlgqdpdsyvgsfdvdqsfvgeianlqmwdyvlssaqikavyy
nqdnrvkgnvfdwdtieydvtgnvlvvpdn

SCOPe Domain Coordinates for d4pbpb_:

Click to download the PDB-style file with coordinates for d4pbpb_.
(The format of our PDB-style files is described here.)

Timeline for d4pbpb_: