Lineage for d4pbpa_ (4pbp A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781809Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1781810Protein automated matches [190437] (37 species)
    not a true protein
  7. 1781930Species Danio rerio [TaxId:7955] [270344] (2 PDB entries)
  8. 1781931Domain d4pbpa_: 4pbp A: [270345]
    automated match to d3pvna_
    complexed with ca, gol

Details for d4pbpa_

PDB Entry: 4pbp (more details), 1.65 Å

PDB Description: crystal structure of zebrafish short-chain pentraxin protein
PDB Compounds: (A:) c-reactive protein

SCOPe Domain Sequences for d4pbpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pbpa_ b.29.1.0 (A:) automated matches {Danio rerio [TaxId: 7955]}
knlsgkvlqfktatdnsyvklypekplslsaftlcmrvatelpldrevilfayytpdvde
lnvwrerdgrvslyiqsskdaaffrlpplstlqthlcvawesatgltafwmdgrrslhqv
yrkgysirsggtvvlgqdpdsyvgsfdvdqsfvgeianlqmwdyvlssaqikavyynqdn
rvkgnvfdwdtieydvtgnvlvvpdn

SCOPe Domain Coordinates for d4pbpa_:

Click to download the PDB-style file with coordinates for d4pbpa_.
(The format of our PDB-style files is described here.)

Timeline for d4pbpa_: