Lineage for d4p8ea_ (4p8e A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971984Fold d.115: YrdC/RibB [55820] (1 superfamily)
    core: alpha-beta(2)-alpha-beta-alpha(2)-beta(2)-alpha-beta-alpha-beta; 3 layers; mixed twisted sheet of 7 strands; order 7126354; strands 7 and 1 are parallel to each other
  4. 2971985Superfamily d.115.1: YrdC/RibB [55821] (3 families) (S)
  5. 2972000Family d.115.1.2: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64372] (2 proteins)
    contains one additional helix in the C-terminal extension
    automatically mapped to Pfam PF00926
  6. 2972027Protein automated matches [190415] (4 species)
    not a true protein
  7. 2972037Species Vibrio cholerae [TaxId:243277] [270331] (6 PDB entries)
  8. 2972046Domain d4p8ea_: 4p8e A: [270343]
    Other proteins in same PDB: d4p8eb2
    automated match to d1ieza_
    complexed with 5rp, edo, zn

Details for d4p8ea_

PDB Entry: 4p8e (more details), 2.04 Å

PDB Description: structure of ribb complexed with substrate (ru5p) and metal ions
PDB Compounds: (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase

SCOPe Domain Sequences for d4p8ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p8ea_ d.115.1.2 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
nqssllaefgdpitrvenalqalregrgvlllddedrenegdiiyaveslttaqmalmir
ecsgivclclteaqadrlalppmvvnnnsanqtaftvsieakhgvttgvsaqdrvttikt
aanpqakpedlarpghvfplraraggvlarrghtegtvdlmqmaglqpagvlceltnpdg
smaktpeiiefgklhnmpvltiedmvqyriqfdlkl

SCOPe Domain Coordinates for d4p8ea_:

Click to download the PDB-style file with coordinates for d4p8ea_.
(The format of our PDB-style files is described here.)

Timeline for d4p8ea_: