![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.115: YrdC/RibB [55820] (1 superfamily) core: alpha-beta(2)-alpha-beta-alpha(2)-beta(2)-alpha-beta-alpha-beta; 3 layers; mixed twisted sheet of 7 strands; order 7126354; strands 7 and 1 are parallel to each other |
![]() | Superfamily d.115.1: YrdC/RibB [55821] (3 families) ![]() |
![]() | Family d.115.1.2: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64372] (2 proteins) contains one additional helix in the C-terminal extension automatically mapped to Pfam PF00926 |
![]() | Protein automated matches [190415] (4 species) not a true protein |
![]() | Species Vibrio cholerae [TaxId:243277] [270331] (6 PDB entries) |
![]() | Domain d4p8eb_: 4p8e B: [270342] automated match to d1ieza_ complexed with 5rp, edo, zn |
PDB Entry: 4p8e (more details), 2.04 Å
SCOPe Domain Sequences for d4p8eb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p8eb_ d.115.1.2 (B:) automated matches {Vibrio cholerae [TaxId: 243277]} shmnqssllaefgdpitrvenalqalregrgvlllddedrenegdiiyaveslttaqmal mirecsgivclclteaqadrlalppmvvnnnsanqtaftvsieakhgvttgvsaqdrvtt iktaanpqakpedlarpghvfplraraggvlarrghtegtvdlmqmaglqpagvlceltn pdgsmaktpeiiefgklhnmpvltiedmvqyriqfdl
Timeline for d4p8eb_: