SCOPe 2.07: Domain d4p6cb_: 4p6c B:

Lineage for d4p6cb_ (4p6c B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.115: YrdC/RibB [55820] (1 superfamily)
   core: alpha-beta(2)-alpha-beta-alpha(2)-beta(2)-alpha-beta-alpha-beta; 3 layers; mixed twisted sheet of 7 strands; order 7126354; strands 7 and 1 are parallel to each other

4. Superfamily d.115.1: YrdC/RibB [55821] (3 families)

5. Family d.115.1.2: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64372] (2 proteins)
   contains one additional helix in the C-terminal extension
   automatically mapped to Pfam PF00926

6. Protein automated matches [190415] (4 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:243277] [270331] (6 PDB entries)

8. Domain d4p6cb_: 4p6c B: [270337]
   automated match to d1ieza_
   complexed with res

Details for d4p6cb_

PDB Entry: 4p6c, 1.86 Å

PDB Description: structure of ribb complexed with inhibitor 4peh

PDB Compounds: (B:) 3,4-dihydroxy-2-butanone 4-phosphate synthase

SCOPe Domain Sequences for d4p6cb_:

Sequence; same for both SEQRES and ATOM records:

>d4p6cb_ d.115.1.2 (B:) automated matches {Vibrio cholerae [TaxId: 243277]}
sllaefgdpitrvenalqalregrgvlllddedrenegdiiyaveslttaqmalmirecs
givclclteaqadrlalppmvvnnnsanqtaftvsieakhgvttgvsaqdrvttiktaan
pqakpedlarpghvfplraraggvlarrghtegtvdlmqmaglqpagvlceltnpdgsma
ktpeiiefgklhnmpvltiedmvqyriqfdlkl

Timeline for d4p6cb_:

• d4p6cb_ first appeared in SCOPe 2.05
  
• d4p6cb_ appears in SCOPe 2.06
  
• d4p6cb_ appears in the current release, SCOPe 2.08