Lineage for d4p6da_ (4p6d A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2211949Fold d.115: YrdC/RibB [55820] (1 superfamily)
    core: alpha-beta(2)-alpha-beta-alpha(2)-beta(2)-alpha-beta-alpha-beta; 3 layers; mixed twisted sheet of 7 strands; order 7126354; strands 7 and 1 are parallel to each other
  4. 2211950Superfamily d.115.1: YrdC/RibB [55821] (3 families) (S)
  5. 2211965Family d.115.1.2: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64372] (2 proteins)
    contains one additional helix in the C-terminal extension
    automatically mapped to Pfam PF00926
  6. 2211992Protein automated matches [190415] (4 species)
    not a true protein
  7. 2212002Species Vibrio cholerae [TaxId:243277] [270331] (6 PDB entries)
  8. 2212003Domain d4p6da_: 4p6d A: [270336]
    automated match to d1ieza_
    complexed with edo, po4

Details for d4p6da_

PDB Entry: 4p6d (more details), 1.59 Å

PDB Description: structure of ribb complexed with po4 ion
PDB Compounds: (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase

SCOPe Domain Sequences for d4p6da_:

Sequence, based on SEQRES records: (download)

>d4p6da_ d.115.1.2 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
sllaefgdpitrvenalqalregrgvlllddedrenegdiiyaveslttaqmalmirecs
givclclteaqadrlalppmvvnnnsanqtaftvsieakhgvttgvsaqdrvttiktaan
pqakpedlarpghvfplraraggvlarrghtegtvdlmqmaglqpagvlceltnpdgsma
ktpeiiefgklhnmpvltiedmvqyriqfdlkla

Sequence, based on observed residues (ATOM records): (download)

>d4p6da_ d.115.1.2 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
sllaefgdpitrvenalqalregrgvlllddedrenegdiiyaveslttaqmalmirecs
givclclteaqadrlalpptvsieakhgvttgvsaqdrvttiktaanpqakpedlarpgh
vfplraraggvlarrghtegtvdlmqmaglqpagvlceltnpdgsmaktpeiiefgklhn
mpvltiedmvqyriqfdlkla

SCOPe Domain Coordinates for d4p6da_:

Click to download the PDB-style file with coordinates for d4p6da_.
(The format of our PDB-style files is described here.)

Timeline for d4p6da_: