| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.115: YrdC/RibB [55820] (1 superfamily) core: alpha-beta(2)-alpha-beta-alpha(2)-beta(2)-alpha-beta-alpha-beta; 3 layers; mixed twisted sheet of 7 strands; order 7126354; strands 7 and 1 are parallel to each other |
Superfamily d.115.1: YrdC/RibB [55821] (3 families) ![]() |
| Family d.115.1.2: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64372] (2 proteins) contains one additional helix in the C-terminal extension automatically mapped to Pfam PF00926 |
| Protein automated matches [190415] (4 species) not a true protein |
| Species Vibrio cholerae [TaxId:243277] [270331] (6 PDB entries) |
| Domain d4p6ca_: 4p6c A: [270335] automated match to d1ieza_ complexed with res |
PDB Entry: 4p6c (more details), 1.86 Å
SCOPe Domain Sequences for d4p6ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p6ca_ d.115.1.2 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
mnqssllaefgdpitrvenalqalregrgvlllddedrenegdiiyaveslttaqmalmi
recsgivclclteaqadrlalppmvvnnnsanqtaftvsieakhgvttgvsaqdrvttik
taanpqakpedlarpghvfplraraggvlarrghtegtvdlmqmaglqpagvlceltnpd
gsmaktpeiiefgklhnmpvltiedmvqyriqfdlkl
Timeline for d4p6ca_: