Lineage for d4p6db_ (4p6d B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2578543Fold d.115: YrdC/RibB [55820] (1 superfamily)
    core: alpha-beta(2)-alpha-beta-alpha(2)-beta(2)-alpha-beta-alpha-beta; 3 layers; mixed twisted sheet of 7 strands; order 7126354; strands 7 and 1 are parallel to each other
  4. 2578544Superfamily d.115.1: YrdC/RibB [55821] (3 families) (S)
  5. 2578559Family d.115.1.2: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64372] (2 proteins)
    contains one additional helix in the C-terminal extension
    automatically mapped to Pfam PF00926
  6. 2578586Protein automated matches [190415] (4 species)
    not a true protein
  7. 2578596Species Vibrio cholerae [TaxId:243277] [270331] (6 PDB entries)
  8. 2578598Domain d4p6db_: 4p6d B: [270334]
    automated match to d1ieza_
    complexed with edo, po4

Details for d4p6db_

PDB Entry: 4p6d (more details), 1.59 Å

PDB Description: structure of ribb complexed with po4 ion
PDB Compounds: (B:) 3,4-dihydroxy-2-butanone 4-phosphate synthase

SCOPe Domain Sequences for d4p6db_:

Sequence, based on SEQRES records: (download)

>d4p6db_ d.115.1.2 (B:) automated matches {Vibrio cholerae [TaxId: 243277]}
llaefgdpitrvenalqalregrgvlllddedrenegdiiyaveslttaqmalmirecsg
ivclclteaqadrlalppmvvnnnsanqtaftvsieakhgvttgvsaqdrvttiktaanp
qakpedlarpghvfplraraggvlarrghtegtvdlmqmaglqpagvlceltnpdgsmak
tpeiiefgklhnmpvltiedmvqyriqfdlkl

Sequence, based on observed residues (ATOM records): (download)

>d4p6db_ d.115.1.2 (B:) automated matches {Vibrio cholerae [TaxId: 243277]}
llaefgdpitrvenalqalregrgvlllddedrenegdiiyaveslttaqmalmirecsg
ivclclteaqadrlalppmaftvsieakhgvttgvsaqdrvttiktaanpqakpedlarp
ghvfplraraggvlarrghtegtvdlmqmaglqpagvlceltnpdgsmaktpeiiefgkl
hnmpvltiedmvqyriqfdlkl

SCOPe Domain Coordinates for d4p6db_:

Click to download the PDB-style file with coordinates for d4p6db_.
(The format of our PDB-style files is described here.)

Timeline for d4p6db_: