Lineage for d4p4qc_ (4p4q C:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1741311Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 1741312Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 1741313Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 1741332Protein Cytochrome c peroxidase, CCP [48119] (1 species)
  7. 1741333Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (176 PDB entries)
    Uniprot P00431
  8. 1741500Domain d4p4qc_: 4p4q C: [270327]
    Other proteins in same PDB: d4p4qb_, d4p4qd_
    automated match to d2bcna_
    complexed with hem

Details for d4p4qc_

PDB Entry: 4p4q (more details), 2.01 Å

PDB Description: complex of yeast cytochrome c peroxidase (w191f) with iso-1 cytochrome c
PDB Compounds: (C:) Cytochrome c peroxidase, mitochondrial

SCOPe Domain Sequences for d4p4qc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p4qc_ a.93.1.1 (C:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkh
dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
gpkipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkt
hlknsgyegpfgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliq
dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

SCOPe Domain Coordinates for d4p4qc_:

Click to download the PDB-style file with coordinates for d4p4qc_.
(The format of our PDB-style files is described here.)

Timeline for d4p4qc_: