Class a: All alpha proteins [46456] (286 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins) |
Protein Medium chain acyl-CoA dehydrogenase, C-domain [47207] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [47209] (5 PDB entries) Uniprot P11310 34-421 |
Domain d4p13c2: 4p13 C:242-396 [270322] Other proteins in same PDB: d4p13a1, d4p13b1, d4p13c1, d4p13d1 automated match to d1egda1 complexed with fad; mutant |
PDB Entry: 4p13 (more details), 1.73 Å
SCOPe Domain Sequences for d4p13c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p13c2 a.29.3.1 (C:242-396) Medium chain acyl-CoA dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]} gagfkvamgafdktrpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaem amevelarmsyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteyp veklmrdakiyqiyegtsqiqrlivarehidkykn
Timeline for d4p13c2: