Lineage for d4p13c2 (4p13 C:242-396)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1731436Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1731940Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 1731941Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins)
  6. 1731982Protein Medium chain acyl-CoA dehydrogenase, C-domain [47207] (3 species)
  7. 1731983Species Human (Homo sapiens) [TaxId:9606] [47209] (5 PDB entries)
    Uniprot P11310 34-421
  8. 1731986Domain d4p13c2: 4p13 C:242-396 [270322]
    Other proteins in same PDB: d4p13a1, d4p13b1, d4p13c1, d4p13d1
    automated match to d1egda1
    complexed with fad; mutant

Details for d4p13c2

PDB Entry: 4p13 (more details), 1.73 Å

PDB Description: medium chain acyl-coa dehydrogenase, k304e mutant
PDB Compounds: (C:) Medium-chain specific acyl-CoA dehydrogenase, mitochondrial

SCOPe Domain Sequences for d4p13c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p13c2 a.29.3.1 (C:242-396) Medium chain acyl-CoA dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]}
gagfkvamgafdktrpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaem
amevelarmsyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteyp
veklmrdakiyqiyegtsqiqrlivarehidkykn

SCOPe Domain Coordinates for d4p13c2:

Click to download the PDB-style file with coordinates for d4p13c2.
(The format of our PDB-style files is described here.)

Timeline for d4p13c2: