Lineage for d4p2ba2 (4p2b A:352-575)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2412454Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily)
    barrel, closed; n=6, S=10; complex topology
  4. 2412455Superfamily b.53.1: Ribosomal protein L25-like [50715] (3 families) (S)
  5. 2412539Family b.53.1.0: automated matches [270315] (1 protein)
    not a true family
  6. 2412540Protein automated matches [270316] (3 species)
    not a true protein
  7. 2412548Species Toxoplasma gondii [TaxId:5811] [270317] (1 PDB entry)
  8. 2412549Domain d4p2ba2: 4p2b A:352-575 [270318]
    Other proteins in same PDB: d4p2ba1, d4p2ba3
    automated match to d2rd2a1
    complexed with so4

Details for d4p2ba2

PDB Entry: 4p2b (more details), 2.8 Å

PDB Description: crystal structure of the apo form of the glutaminyl-trna synthetase catalytic domain from toxoplasma gondii.
PDB Compounds: (A:) Glutamine aminoacyl-tRNA synthetase

SCOPe Domain Sequences for d4p2ba2:

Sequence, based on SEQRES records: (download)

>d4p2ba2 b.53.1.0 (A:352-575) automated matches {Toxoplasma gondii [TaxId: 5811]}
ahrrfaiqdpiavtitnygdkvetitaanhpedesfgtrelhfskklyidrddfmenppa
gyrrlapgaevrlkhaywikcvdvvkdasglvtellctydpqtkncsvapdgrkvkgaih
wlsekdavpaeirifgrlftkpnpeeedesnpnaswreninkeslkvykgfversaadsa
afppqsslqferlgfftpdgstlpeeadntktrtlpvfnltval

Sequence, based on observed residues (ATOM records): (download)

>d4p2ba2 b.53.1.0 (A:352-575) automated matches {Toxoplasma gondii [TaxId: 5811]}
ahrrfaiqdpiavtitnygdkvetitarelhfskklyidrddfmenppagyrrlapgaev
rlkhaywikcvdvvkdasglvtellctydpqtknpdgrkvkgaihwlsekdavpaeirif
grlftkpnpwreninkeslkvykgfversaadsaafppqsslqferlgfftpdgstltlp
vfnltval

SCOPe Domain Coordinates for d4p2ba2:

Click to download the PDB-style file with coordinates for d4p2ba2.
(The format of our PDB-style files is described here.)

Timeline for d4p2ba2: