Lineage for d4p2ba1 (4p2b A:22-351)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2106026Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2106027Protein automated matches [190459] (50 species)
    not a true protein
  7. 2106226Species Toxoplasma gondii [TaxId:5811] [270313] (1 PDB entry)
  8. 2106227Domain d4p2ba1: 4p2b A:22-351 [270314]
    Other proteins in same PDB: d4p2ba2, d4p2ba3
    automated match to d1qtqa2
    complexed with so4

Details for d4p2ba1

PDB Entry: 4p2b (more details), 2.8 Å

PDB Description: crystal structure of the apo form of the glutaminyl-trna synthetase catalytic domain from toxoplasma gondii.
PDB Compounds: (A:) Glutamine aminoacyl-tRNA synthetase

SCOPe Domain Sequences for d4p2ba1:

Sequence, based on SEQRES records: (download)

>d4p2ba1 c.26.1.0 (A:22-351) automated matches {Toxoplasma gondii [TaxId: 5811]}
vnflkqiveedlrtgkhktvitrfppepngflhlghaksvclnfglakafggrchlrfdd
tnpmkeetryiesiqrdvrwlggdwgnhlyyasdyfqqlydwaellikkglafvdddsle
eirrkrgsisqpgenspfrersieenldlfrrmragefeegsrvlrakidmthsnmnmrd
pvlyrilkkehprtgnqwviypmydyahgqsdsienithsictlefdlhrilydwfqekl
eitrtrqiefarlnvtytvmskrkllalvtekwvdgwddprlptlsglrrrgvppsalrd
fcdkvgvarrestikvevlekcirdalhvv

Sequence, based on observed residues (ATOM records): (download)

>d4p2ba1 c.26.1.0 (A:22-351) automated matches {Toxoplasma gondii [TaxId: 5811]}
vnflkqiveedlrtgtvitrfppepngflhlghaksvclnfglakafggrchlrfddtnp
mkeetryiesiqrdvrwlggdwgnhlyyasdyfqqlydwaellikkglafvdddsleeir
rkrenspfrersieenldlfrrmragefeegsrvlrakidmthsnmnmrdpvlyrilkke
hprtgnqwviypmydyahgqsdsienithsiclhrilydwfqekleitrtrqiefarlnv
tytvmskrkllalvtekwvdgwddprlptlsglrrrgvppsalrdfcdkvgvarrestik
vevlekcirdalhvv

SCOPe Domain Coordinates for d4p2ba1:

Click to download the PDB-style file with coordinates for d4p2ba1.
(The format of our PDB-style files is described here.)

Timeline for d4p2ba1: