Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (96 species) not a true protein |
Species Bacillus subtilis [TaxId:655816] [261215] (2 PDB entries) |
Domain d4oyha_: 4oyh A: [270308] automated match to d4nkrb_ complexed with so4 |
PDB Entry: 4oyh (more details), 2.41 Å
SCOPe Domain Sequences for d4oyha_:
Sequence, based on SEQRES records: (download)
>d4oyha_ c.37.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 655816]} fpivqvvgfqnsgkttfierilekaseqglnlgclkhhghggepqtftegkdtdryqaag advtavegagvlqltarrlwdltrlielyqfletdclliegfkkapypkvvilsekedle alktvntiaiiyrkkehmtehqglpifhaddpvavdlvlsqlk
>d4oyha_ c.37.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 655816]} fpivqvvgfqnsgkttfierilekaseqglnlgclkhhdryqaagadvtavegagvlqlt arrlwdltrlielyqfletdclliegfkkapypkvvilsekedlealktvntiaiiyrkk ehmtehqglpifhaddpvavdlvlsqlk
Timeline for d4oyha_:
View in 3D Domains from other chains: (mouse over for more information) d4oyhb_, d4oyhc_, d4oyhd_, d4oyhe_ |