Lineage for d4oyha1 (4oyh A:11-172)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2871672Species Bacillus subtilis [TaxId:655816] [261215] (2 PDB entries)
  8. 2871678Domain d4oyha1: 4oyh A:11-172 [270308]
    Other proteins in same PDB: d4oyha2, d4oyhb2, d4oyhc2, d4oyhd2, d4oyhe2
    automated match to d4nkrb_
    complexed with so4

Details for d4oyha1

PDB Entry: 4oyh (more details), 2.41 Å

PDB Description: structure of bacillus subtilis mobb
PDB Compounds: (A:) Molybdopterin-guanine dinucleotide biosynthesis protein B

SCOPe Domain Sequences for d4oyha1:

Sequence, based on SEQRES records: (download)

>d4oyha1 c.37.1.0 (A:11-172) automated matches {Bacillus subtilis [TaxId: 655816]}
pivqvvgfqnsgkttfierilekaseqglnlgclkhhghggepqtftegkdtdryqaaga
dvtavegagvlqltarrlwdltrlielyqfletdclliegfkkapypkvvilsekedlea
lktvntiaiiyrkkehmtehqglpifhaddpvavdlvlsqlk

Sequence, based on observed residues (ATOM records): (download)

>d4oyha1 c.37.1.0 (A:11-172) automated matches {Bacillus subtilis [TaxId: 655816]}
pivqvvgfqnsgkttfierilekaseqglnlgclkhhdryqaagadvtavegagvlqlta
rrlwdltrlielyqfletdclliegfkkapypkvvilsekedlealktvntiaiiyrkke
hmtehqglpifhaddpvavdlvlsqlk

SCOPe Domain Coordinates for d4oyha1:

Click to download the PDB-style file with coordinates for d4oyha1.
(The format of our PDB-style files is described here.)

Timeline for d4oyha1: