SCOPe 2.08: Domain d4oyha1: 4oyh A:11-172

Lineage for d4oyha1 (4oyh A:11-172)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:655816] [261215] (2 PDB entries)

8. Domain d4oyha1: 4oyh A:11-172 [270308]
   Other proteins in same PDB: d4oyha2, d4oyhb2, d4oyhc2, d4oyhd2, d4oyhe2
   automated match to d4nkrb_
   complexed with so4

Details for d4oyha1

PDB Entry: 4oyh, 2.41 Å

PDB Description: structure of bacillus subtilis mobb

PDB Compounds: (A:) Molybdopterin-guanine dinucleotide biosynthesis protein B

SCOPe Domain Sequences for d4oyha1:

Sequence, based on SEQRES records:

>d4oyha1 c.37.1.0 (A:11-172) automated matches {Bacillus subtilis [TaxId: 655816]}
pivqvvgfqnsgkttfierilekaseqglnlgclkhhghggepqtftegkdtdryqaaga
dvtavegagvlqltarrlwdltrlielyqfletdclliegfkkapypkvvilsekedlea
lktvntiaiiyrkkehmtehqglpifhaddpvavdlvlsqlk

Sequence, based on observed residues (ATOM records):

>d4oyha1 c.37.1.0 (A:11-172) automated matches {Bacillus subtilis [TaxId: 655816]}
pivqvvgfqnsgkttfierilekaseqglnlgclkhhdryqaagadvtavegagvlqlta
rrlwdltrlielyqfletdclliegfkkapypkvvilsekedlealktvntiaiiyrkke
hmtehqglpifhaddpvavdlvlsqlk

Timeline for d4oyha1:

• d4oyha1 first appeared in SCOPe 2.05, called d4oyha_
  
• d4oyha1 appears in SCOPe 2.07